Anti-TNN
Catalog Number:
ATA-HPA026764
- Images (7)
| Article Name: | Anti-TNN |
| Biozol Catalog Number: | ATA-HPA026764 |
| Supplier Catalog Number: | HPA026764 |
| Alternative Catalog Number: | ATA-HPA026764-100,ATA-HPA026764-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TNN |
| tenascin N |
| Anti-TNN |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 63923 |
| UniProt: | Q9UQP3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KEQQVTVSHTYKIDVPKSALVQVDADPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMVEMKEQCSA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TNN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human breast shows moderate to strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human salivary gland shows weak cytoplasmic and moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in a subset of glandular cells. |
|
|
HPA026764-100ul |
|
|
HPA026764-100ul |
|
|
HPA026764-100ul |
Product Guarantee and Expert Support
