Anti-GCNT2
Artikelnummer:
ATA-HPA026776
- Bilder (8)
| Artikelname: | Anti-GCNT2 |
| Artikelnummer: | ATA-HPA026776 |
| Hersteller Artikelnummer: | HPA026776 |
| Alternativnummer: | ATA-HPA026776-100,ATA-HPA026776-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA360O19.2, bA421M1.1, CCAT, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3 |
| glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) |
| Anti-GCNT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2651 |
| UniProt: | Q8N0V5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GCNT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human small intestine shows granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-GCNT2 antibody. Corresponding GCNT2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line EFO-21. |
|
|
HPA026776-100ul |
|
|
|
|
|
HPA026776-100ul |
|
|
HPA026776-100ul |
Produktgarantie und fachkundiger Support
