Anti-GCNT2

Catalog Number: ATA-HPA026776
Article Name: Anti-GCNT2
Biozol Catalog Number: ATA-HPA026776
Supplier Catalog Number: HPA026776
Alternative Catalog Number: ATA-HPA026776-100,ATA-HPA026776-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA360O19.2, bA421M1.1, CCAT, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Anti-GCNT2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2651
UniProt: Q8N0V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GCNT2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Immunohistochemical staining of human small intestine shows granular cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-GCNT2 antibody. Corresponding GCNT2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line EFO-21.
HPA026776-100ul
HPA026776-100ul
HPA026776-100ul