Anti-SPINK2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026813
Artikelname: Anti-SPINK2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026813
Hersteller Artikelnummer: HPA026813
Alternativnummer: ATA-HPA026813-100,ATA-HPA026813-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HUSI-II
serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
Anti-SPINK2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6691
UniProt: P20155
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPINK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human epididymis and kidney tissues using HPA026813 antibody. Corresponding SPINK2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human kidney shows no cytoplasmic positivity in cells in tubules as expected.
Immunohistochemical staining of human epididymis shows very strong cytoplasmic positivity in glandular cells.
HPA026813
HPA026813
HPA026813