Anti-SPINK2

Catalog Number: ATA-HPA026813
Article Name: Anti-SPINK2
Biozol Catalog Number: ATA-HPA026813
Supplier Catalog Number: HPA026813
Alternative Catalog Number: ATA-HPA026813-100,ATA-HPA026813-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HUSI-II
serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
Anti-SPINK2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6691
UniProt: P20155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPINK2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human epididymis and kidney tissues using HPA026813 antibody. Corresponding SPINK2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human kidney shows no cytoplasmic positivity in cells in tubules as expected.
Immunohistochemical staining of human epididymis shows very strong cytoplasmic positivity in glandular cells.
HPA026813-100ul
HPA026813-100ul
HPA026813-100ul