Anti-SPINK2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SPINK2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026813
• Supplier Catalog Number: HPA026813
• Alternative Catalog Number: ATA-HPA026813-100,ATA-HPA026813-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HUSI-II

Product Description

serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)

Additional Information

Anti-SPINK2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 6691
• UniProt: P20155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SPINK2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human epididymis and kidney tissues using HPA026813 antibody. Corresponding SPINK2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human fallopian tube shows no cytoplasmic positivity in glandular cells as expected.

Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human kidney shows no cytoplasmic positivity in cells in tubules as expected.

Immunohistochemical staining of human epididymis shows very strong cytoplasmic positivity in glandular cells.

HPA026813

HPA026813

HPA026813