Anti-PCDH17

Artikelnummer: ATA-HPA026817
Artikelname: Anti-PCDH17
Artikelnummer: ATA-HPA026817
Hersteller Artikelnummer: HPA026817
Alternativnummer: ATA-HPA026817-100,ATA-HPA026817-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PCDH68, PCH68
protocadherin 17
Anti-PCDH17
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 27253
UniProt: O14917
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PCDH17
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.
Immunohistochemical staining of human pancreas shows strong membranous positivity in exocrine glandular cells.
Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
HPA026817-100ul
HPA026817-100ul
HPA026817-100ul