Anti-PCDH17 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PCDH17 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026817
• Supplier Catalog Number: HPA026817
• Alternative Catalog Number: ATA-HPA026817-100,ATA-HPA026817-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PCDH68, PCH68

Product Description

protocadherin 17

Additional Information

Anti-PCDH17

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 27253
• UniProt: O14917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PCDH17
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.

Immunohistochemical staining of human pancreas shows strong membranous positivity in exocrine glandular cells.

Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.

Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells.

Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.

HPA026817

HPA026817

HPA026817