Anti-PCDH17 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026817
| Article Name: |
Anti-PCDH17 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA026817 |
| Supplier Catalog Number: |
HPA026817 |
| Alternative Catalog Number: |
ATA-HPA026817-100,ATA-HPA026817-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
PCDH68, PCH68 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
27253 |
| UniProt: |
O14917 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
PCDH17 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles. |
|
Immunohistochemical staining of human pancreas shows strong membranous positivity in exocrine glandular cells. |
|
Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes. |
|
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells. |
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
HPA026817 |
|
|
|
HPA026817 |
|
HPA026817 |