Anti-GANAB Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA026874
- Bilder (9)
| Artikelname: | Anti-GANAB Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA026874 |
| Hersteller Artikelnummer: | HPA026874 |
| Alternativnummer: | ATA-HPA026874-100,ATA-HPA026874-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G2AN, GluII, KIAA0088 |
| glucosidase, alpha, neutral AB |
| Anti-GANAB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23193 |
| UniProt: | Q14697 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GANAB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody HPA026874 (A) shows similar protein distribution across tissues to independent antibody HPA061426 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human thyroid gland shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-GANAB antibody HPA026874. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-GANAB antibody HPA026874. |
|
|
HPA026874 |
|
|
HPA026874 |
|
|
HPA026874 |
Produktgarantie und fachkundiger Support
