Anti-GANAB

Catalog Number: ATA-HPA026874
Article Name: Anti-GANAB
Biozol Catalog Number: ATA-HPA026874
Supplier Catalog Number: HPA026874
Alternative Catalog Number: ATA-HPA026874-100,ATA-HPA026874-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: G2AN, GluII, KIAA0088
glucosidase, alpha, neutral AB
Anti-GANAB
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23193
UniProt: Q14697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GANAB
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody HPA026874 (A) shows similar protein distribution across tissues to independent antibody HPA061426 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human colon using Anti-GANAB antibody HPA026874.
Immunohistochemical staining of human cerebral cortex using Anti-GANAB antibody HPA026874.
HPA026874-100ul
HPA026874-100ul
HPA026874-100ul