Anti-SCNN1D

Artikelnummer: ATA-HPA026884
Artikelname: Anti-SCNN1D
Artikelnummer: ATA-HPA026884
Hersteller Artikelnummer: HPA026884
Alternativnummer: ATA-HPA026884-100,ATA-HPA026884-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: dNaCh, ENaCdelta
sodium channel, non-voltage-gated 1, delta subunit
Anti-SCNN1D
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6339
UniProt: P51172
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SCNN1D
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SCNN1D antibody. Corresponding SCNN1D RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA026884-100ul
HPA026884-100ul
HPA026884-100ul