Anti-SCNN1D

Catalog Number: ATA-HPA026884
Article Name: Anti-SCNN1D
Biozol Catalog Number: ATA-HPA026884
Supplier Catalog Number: HPA026884
Alternative Catalog Number: ATA-HPA026884-100,ATA-HPA026884-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dNaCh, ENaCdelta
sodium channel, non-voltage-gated 1, delta subunit
Anti-SCNN1D
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6339
UniProt: P51172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SCNN1D
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SCNN1D antibody. Corresponding SCNN1D RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA026884-100ul
HPA026884-100ul
HPA026884-100ul