Anti-ATOH7, Rabbit, Polyclonal

Artikelnummer: ATA-HPA027008
Artikelname: Anti-ATOH7, Rabbit, Polyclonal
Artikelnummer: ATA-HPA027008
Hersteller Artikelnummer: HPA027008
Alternativnummer: ATA-HPA027008-100,ATA-HPA027008-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHa13, Math5
atonal homolog 7 (Drosophila)
Anti-ATOH7
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 220202
UniProt: Q8N100
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.
Immunohistochemical staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.