Anti-ATOH7, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ATOH7, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA027008
• Supplier Catalog Number: HPA027008
• Alternative Catalog Number: ATA-HPA027008-100,ATA-HPA027008-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bHLHa13, Math5

Product Description

atonal homolog 7 (Drosophila)

Additional Information

Anti-ATOH7

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 220202
• UniProt: Q8N100
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.

Immunohistochemical staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.