Anti-EYA2

Artikelnummer: ATA-HPA027024
Artikelname: Anti-EYA2
Artikelnummer: ATA-HPA027024
Hersteller Artikelnummer: HPA027024
Alternativnummer: ATA-HPA027024-100,ATA-HPA027024-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EAB1
EYA transcriptional coactivator and phosphatase 2
Anti-EYA2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 2139
UniProt: O00167
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EYA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human liver shows weak to moderate nuclear positivity in hepatocytes.
Western blot analysis in human cell line SCLC-21H.
HPA027024-100ul
HPA027024-100ul
HPA027024-100ul