Anti-EYA2

Catalog Number: ATA-HPA027024
Article Name: Anti-EYA2
Biozol Catalog Number: ATA-HPA027024
Supplier Catalog Number: HPA027024
Alternative Catalog Number: ATA-HPA027024-100,ATA-HPA027024-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EAB1
EYA transcriptional coactivator and phosphatase 2
Anti-EYA2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2139
UniProt: O00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: EYA2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human liver shows weak to moderate nuclear positivity in hepatocytes.
Western blot analysis in human cell line SCLC-21H.
HPA027024-100ul
HPA027024-100ul
HPA027024-100ul