Anti-EYA2
Catalog Number:
ATA-HPA027024
- Images (9)
| Article Name: | Anti-EYA2 |
| Biozol Catalog Number: | ATA-HPA027024 |
| Supplier Catalog Number: | HPA027024 |
| Alternative Catalog Number: | ATA-HPA027024-100,ATA-HPA027024-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EAB1 |
| EYA transcriptional coactivator and phosphatase 2 |
| Anti-EYA2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 2139 |
| UniProt: | O00167 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EYA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows weak to moderate nuclear positivity in hepatocytes. |
|
|
Western blot analysis in human cell line SCLC-21H. |
|
|
HPA027024 |
|
|
|
|
|
HPA027024 |
|
|
HPA027024 |
Product Guarantee and Expert Support
