Anti-GPER1
Artikelnummer:
ATA-HPA027052
- Bilder (7)
| Artikelname: | Anti-GPER1 |
| Artikelnummer: | ATA-HPA027052 |
| Hersteller Artikelnummer: | HPA027052 |
| Alternativnummer: | ATA-HPA027052-100,ATA-HPA027052-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR |
| G protein-coupled estrogen receptor 1 |
| Anti-GPER1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2852 |
| UniProt: | Q99527 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in lymphocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak positivity in neuropil. |
|
|
HPA027052-100ul |
|
|
HPA027052-100ul |
|
|
HPA027052-100ul |
Produktgarantie und fachkundiger Support
