Anti-GPER1
Catalog Number:
ATA-HPA027052
- Images (7)
| Article Name: | Anti-GPER1 |
| Biozol Catalog Number: | ATA-HPA027052 |
| Supplier Catalog Number: | HPA027052 |
| Alternative Catalog Number: | ATA-HPA027052-100,ATA-HPA027052-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR |
| G protein-coupled estrogen receptor 1 |
| Anti-GPER1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 2852 |
| UniProt: | Q99527 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GPER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in lymphocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak positivity in neuropil. |
|
|
HPA027052-100ul |
|
|
HPA027052-100ul |
|
|
HPA027052-100ul |
Product Guarantee and Expert Support
