Anti-ADPRHL2

Artikelnummer: ATA-HPA027104
Artikelname: Anti-ADPRHL2
Artikelnummer: ATA-HPA027104
Hersteller Artikelnummer: HPA027104
Alternativnummer: ATA-HPA027104-100,ATA-HPA027104-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARH3, FLJ20446
ADP-ribosylhydrolase like 2
Anti-ADPRHL2
Klonalität: Polyclonal
Konzentration: 0.7 mg/ml
Isotyp: IgG
NCBI: 54936
UniProt: Q9NX46
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADPRHL2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADPRHL2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA027104-100ul
HPA027104-100ul
HPA027104-100ul