Anti-ADPRHL2

Catalog Number: ATA-HPA027104
Article Name: Anti-ADPRHL2
Biozol Catalog Number: ATA-HPA027104
Supplier Catalog Number: HPA027104
Alternative Catalog Number: ATA-HPA027104-100,ATA-HPA027104-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARH3, FLJ20446
ADP-ribosylhydrolase like 2
Anti-ADPRHL2
Clonality: Polyclonal
Concentration: 0.7 mg/ml
Isotype: IgG
NCBI: 54936
UniProt: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADPRHL2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADPRHL2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA027104-100ul
HPA027104-100ul
HPA027104-100ul