Anti-CCDC181

Artikelnummer: ATA-HPA027281
Artikelname: Anti-CCDC181
Artikelnummer: ATA-HPA027281
Hersteller Artikelnummer: HPA027281
Alternativnummer: ATA-HPA027281-100,ATA-HPA027281-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C1orf114, FLJ25846
coiled-coil domain containing 181
Anti-CCDC181
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 57821
UniProt: Q5TID7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CCDC181
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CCDC181 antibody. Corresponding CCDC181 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody HPA027281 (A) shows similar protein distribution across tissues to independent antibody HPA027189 (B).
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human liver using Anti-CCDC181 antibody HPA027281.
Immunohistochemical staining of human bronchus using Anti-CCDC181 antibody HPA027281.
HPA027281-100ul
HPA027281-100ul
HPA027281-100ul