Anti-CCDC181
Catalog Number:
ATA-HPA027281
- Images (9)
| Article Name: | Anti-CCDC181 |
| Biozol Catalog Number: | ATA-HPA027281 |
| Supplier Catalog Number: | HPA027281 |
| Alternative Catalog Number: | ATA-HPA027281-100,ATA-HPA027281-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf114, FLJ25846 |
| coiled-coil domain containing 181 |
| Anti-CCDC181 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 57821 |
| UniProt: | Q5TID7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC181 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CCDC181 antibody. Corresponding CCDC181 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody HPA027281 (A) shows similar protein distribution across tissues to independent antibody HPA027189 (B). |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-CCDC181 antibody HPA027281. |
|
|
Immunohistochemical staining of human bronchus using Anti-CCDC181 antibody HPA027281. |
|
|
HPA027281 |
|
|
HPA027281 |
|
|
HPA027281 |
Product Guarantee and Expert Support
