Anti-CRP

Artikelnummer: ATA-HPA027367
Artikelname: Anti-CRP
Artikelnummer: ATA-HPA027367
Hersteller Artikelnummer: HPA027367
Alternativnummer: ATA-HPA027367-100,ATA-HPA027367-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PTX1
C-reactive protein, pentraxin-related
Anti-CRP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1401
UniProt: P02741
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CRP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human duodenum shows moderate positivity in plasma in blood vessels.
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity as expected.
Western blot analysis using Anti-CRP antibody HPA027367 (A) shows similar pattern to independent antibody HPA027396 (B).
Western blot analysis in human plasma.
HPA027367-100ul
HPA027367-100ul
HPA027367-100ul