Anti-CRP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA027367
- Bilder (9)
| Artikelname: | Anti-CRP Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA027367 |
| Hersteller Artikelnummer: | HPA027367 |
| Alternativnummer: | ATA-HPA027367-100,ATA-HPA027367-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PTX1 |
| C-reactive protein, pentraxin-related |
| Anti-CRP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1401 |
| UniProt: | P02741 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CRP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows moderate positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity as expected. |
|
|
Western blot analysis using Anti-CRP antibody HPA027367 (A) shows similar pattern to independent antibody HPA027396 (B). |
|
|
Western blot analysis in human plasma. |
|
|
HPA027367 |
|
|
|
|
|
HPA027367 |
|
|
HPA027367 |
Produktgarantie und fachkundiger Support
