Anti-CRP

Catalog Number: ATA-HPA027367
Article Name: Anti-CRP
Biozol Catalog Number: ATA-HPA027367
Supplier Catalog Number: HPA027367
Alternative Catalog Number: ATA-HPA027367-100,ATA-HPA027367-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PTX1
C-reactive protein, pentraxin-related
Anti-CRP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1401
UniProt: P02741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CRP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human duodenum shows moderate positivity in plasma in blood vessels.
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity as expected.
Western blot analysis using Anti-CRP antibody HPA027367 (A) shows similar pattern to independent antibody HPA027396 (B).
Western blot analysis in human plasma.
HPA027367-100ul
HPA027367-100ul
HPA027367-100ul