Anti-CRP Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA027367
- Images (9)
| Article Name: | Anti-CRP Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA027367 |
| Supplier Catalog Number: | HPA027367 |
| Alternative Catalog Number: | ATA-HPA027367-100,ATA-HPA027367-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PTX1 |
| C-reactive protein, pentraxin-related |
| Anti-CRP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1401 |
| UniProt: | P02741 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CRP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows moderate positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity as expected. |
|
|
Western blot analysis using Anti-CRP antibody HPA027367 (A) shows similar pattern to independent antibody HPA027396 (B). |
|
|
Western blot analysis in human plasma. |
|
|
HPA027367 |
|
|
|
|
|
HPA027367 |
|
|
HPA027367 |
Product Guarantee and Expert Support
