Anti-USH1C
Artikelnummer:
ATA-HPA027398
- Bilder (7)
| Artikelname: | Anti-USH1C |
| Artikelnummer: | ATA-HPA027398 |
| Hersteller Artikelnummer: | HPA027398 |
| Alternativnummer: | ATA-HPA027398-100,ATA-HPA027398-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C |
| Usher syndrome 1C (autosomal recessive, severe) |
| Anti-USH1C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10083 |
| UniProt: | Q9Y6N9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | USH1C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and PC-3 using Anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA027398-100ul |
|
|
HPA027398-100ul |
|
|
HPA027398-100ul |
Produktgarantie und fachkundiger Support
