Anti-USH1C
Catalog Number:
ATA-HPA027398
- Images (7)
| Article Name: | Anti-USH1C |
| Biozol Catalog Number: | ATA-HPA027398 |
| Supplier Catalog Number: | HPA027398 |
| Alternative Catalog Number: | ATA-HPA027398-100,ATA-HPA027398-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C |
| Usher syndrome 1C (autosomal recessive, severe) |
| Anti-USH1C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10083 |
| UniProt: | Q9Y6N9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | USH1C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and PC-3 using Anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA027398-100ul |
|
|
HPA027398-100ul |
|
|
HPA027398-100ul |
Product Guarantee and Expert Support
