Anti-BAX

Artikelnummer: ATA-HPA027878
Artikelname: Anti-BAX
Artikelnummer: ATA-HPA027878
Hersteller Artikelnummer: HPA027878
Alternativnummer: ATA-HPA027878-100,ATA-HPA027878-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BCL2L4
BCL2-associated X protein
Anti-BAX
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 581
UniProt: Q07812
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BAX
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BAX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HPA027878-100ul
HPA027878-100ul
HPA027878-100ul