Anti-BAX

Catalog Number: ATA-HPA027878
Article Name: Anti-BAX
Biozol Catalog Number: ATA-HPA027878
Supplier Catalog Number: HPA027878
Alternative Catalog Number: ATA-HPA027878-100,ATA-HPA027878-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BCL2L4
BCL2-associated X protein
Anti-BAX
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 581
UniProt: Q07812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BAX
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BAX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HPA027878-100ul
HPA027878-100ul
HPA027878-100ul