Anti-NUP153
Artikelnummer:
ATA-HPA027898
- Bilder (9)
| Artikelname: | Anti-NUP153 |
| Artikelnummer: | ATA-HPA027898 |
| Hersteller Artikelnummer: | HPA027898 |
| Alternativnummer: | ATA-HPA027898-100,ATA-HPA027898-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HNUP153 |
| nucleoporin 153kDa |
| Anti-NUP153 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9972 |
| UniProt: | P49790 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NUP153 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane. |
|
|
Immunohistochemical staining of human pancreas shows very weak positivity in nuclear membrane in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in nuclear membrane in neurons. |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate positivity in nuclear membrane in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in nuclear membrane in cells in seminiferous ducts. |
|
|
HPA027898-100ul |
|
|
|
|
|
HPA027898-100ul |
|
|
HPA027898-100ul |
Produktgarantie und fachkundiger Support
