Anti-NUP153
Catalog Number:
ATA-HPA027898
- Images (9)
| Article Name: | Anti-NUP153 |
| Biozol Catalog Number: | ATA-HPA027898 |
| Supplier Catalog Number: | HPA027898 |
| Alternative Catalog Number: | ATA-HPA027898-100,ATA-HPA027898-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HNUP153 |
| nucleoporin 153kDa |
| Anti-NUP153 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9972 |
| UniProt: | P49790 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUP153 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane. |
|
|
Immunohistochemical staining of human pancreas shows very weak positivity in nuclear membrane in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in nuclear membrane in neurons. |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate positivity in nuclear membrane in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in nuclear membrane in cells in seminiferous ducts. |
|
|
HPA027898-100ul |
|
|
|
|
|
HPA027898-100ul |
|
|
HPA027898-100ul |
Product Guarantee and Expert Support
