Anti-RTCA
Artikelnummer:
ATA-HPA027982
- Bilder (7)
| Artikelname: | Anti-RTCA |
| Artikelnummer: | ATA-HPA027982 |
| Hersteller Artikelnummer: | HPA027982 |
| Alternativnummer: | ATA-HPA027982-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RPC, RTC1, RTCD1 |
| RNA 3-terminal phosphate cyclase |
| Anti-RTCA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8634 |
| UniProt: | O00442 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RTCA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus. |
|
|
Immunohistochemical staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis using Anti-RTCA antibody HPA027982 (A) shows similar pattern to independent antibody HPA027990 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA027982-100ul |
|
|
HPA027982-100ul |
|
|
HPA027982-100ul |
Produktgarantie und fachkundiger Support
