Anti-RTCA

Catalog Number: ATA-HPA027982
Article Name: Anti-RTCA
Biozol Catalog Number: ATA-HPA027982
Supplier Catalog Number: HPA027982
Alternative Catalog Number: ATA-HPA027982-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RPC, RTC1, RTCD1
RNA 3-terminal phosphate cyclase
Anti-RTCA
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8634
UniProt: O00442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RTCA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemical staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.
Western blot analysis using Anti-RTCA antibody HPA027982 (A) shows similar pattern to independent antibody HPA027990 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA027982-100ul
HPA027982-100ul
HPA027982-100ul