Anti-NVL

Artikelnummer: ATA-HPA028224
Artikelname: Anti-NVL
Artikelnummer: ATA-HPA028224
Hersteller Artikelnummer: HPA028224
Alternativnummer: ATA-HPA028224-100,ATA-HPA028224-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NVL
nuclear VCP-like
Anti-NVL
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 4931
UniProt: O15381
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NVL
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli.
Immunohistochemistry analysis in human skin and pancreas tissues using Anti-NVL antibody. Corresponding NVL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA028224-100ul
HPA028224-100ul
HPA028224-100ul