Anti-NVL

Catalog Number: ATA-HPA028224
Article Name: Anti-NVL
Biozol Catalog Number: ATA-HPA028224
Supplier Catalog Number: HPA028224
Alternative Catalog Number: ATA-HPA028224-100,ATA-HPA028224-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NVL
nuclear VCP-like
Anti-NVL
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4931
UniProt: O15381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NVL
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli.
Immunohistochemistry analysis in human skin and pancreas tissues using Anti-NVL antibody. Corresponding NVL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA028224-100ul
HPA028224-100ul
HPA028224-100ul