Anti-DDX54
Artikelnummer:
ATA-HPA028244
- Bilder (7)
| Artikelname: | Anti-DDX54 |
| Artikelnummer: | ATA-HPA028244 |
| Hersteller Artikelnummer: | HPA028244 |
| Alternativnummer: | ATA-HPA028244-100,ATA-HPA028244-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APR-5, DP97, MGC2835 |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
| Anti-DDX54 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79039 |
| UniProt: | Q8TDD1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DDX54 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nucleolar positivity in cells in tubules. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate positivity in nucleoli of glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in nucleoli of neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate positivity in nucleoli of myocytes. |
|
|
HPA028244-100ul |
|
|
HPA028244-100ul |
|
|
HPA028244-100ul |
Produktgarantie und fachkundiger Support
