Anti-DDX54
Catalog Number:
ATA-HPA028244
- Images (7)
| Article Name: | Anti-DDX54 |
| Biozol Catalog Number: | ATA-HPA028244 |
| Supplier Catalog Number: | HPA028244 |
| Alternative Catalog Number: | ATA-HPA028244-100,ATA-HPA028244-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APR-5, DP97, MGC2835 |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
| Anti-DDX54 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79039 |
| UniProt: | Q8TDD1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DDX54 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nucleolar positivity in cells in tubules. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate positivity in nucleoli of glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in nucleoli of neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate positivity in nucleoli of myocytes. |
|
|
HPA028244-100ul |
|
|
HPA028244-100ul |
|
|
HPA028244-100ul |
Product Guarantee and Expert Support
