Anti-CCSAP
Artikelnummer:
ATA-HPA028402
- Bilder (9)
| Artikelname: | Anti-CCSAP |
| Artikelnummer: | ATA-HPA028402 |
| Hersteller Artikelnummer: | HPA028402 |
| Alternativnummer: | ATA-HPA028402-100,ATA-HPA028402-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C1orf96, CSAP, FLJ41471 |
| centriole, cilia and spindle-associated protein |
| Anti-CCSAP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 126731 |
| UniProt: | Q6IQ19 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCSAP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CCSAP antibody. Corresponding CCSAP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-CCSAP antibody HPA028402 (A) shows similar protein distribution across tissues to independent antibody HPA043443 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-CCSAP antibody HPA028402. |
|
|
Immunohistochemical staining of human cerebellum using Anti-CCSAP antibody HPA028402. |
|
|
HPA028402-100ul |
|
|
HPA028402-100ul |
|
|
HPA028402-100ul |
Produktgarantie und fachkundiger Support
