Anti-CCSAP
Catalog Number:
ATA-HPA028402
- Images (9)
| Article Name: | Anti-CCSAP |
| Biozol Catalog Number: | ATA-HPA028402 |
| Supplier Catalog Number: | HPA028402 |
| Alternative Catalog Number: | ATA-HPA028402-100,ATA-HPA028402-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf96, CSAP, FLJ41471 |
| centriole, cilia and spindle-associated protein |
| Anti-CCSAP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 126731 |
| UniProt: | Q6IQ19 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCSAP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CCSAP antibody. Corresponding CCSAP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-CCSAP antibody HPA028402 (A) shows similar protein distribution across tissues to independent antibody HPA043443 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-CCSAP antibody HPA028402. |
|
|
Immunohistochemical staining of human cerebellum using Anti-CCSAP antibody HPA028402. |
|
|
HPA028402-100ul |
|
|
HPA028402-100ul |
|
|
HPA028402-100ul |
Product Guarantee and Expert Support
