Anti-SPAG17
Artikelnummer:
ATA-HPA028597
- Bilder (8)
| Artikelname: | Anti-SPAG17 |
| Artikelnummer: | ATA-HPA028597 |
| Hersteller Artikelnummer: | HPA028597 |
| Alternativnummer: | ATA-HPA028597-100,ATA-HPA028597-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT143, FLJ34497, PF6, RP4-776P7.2 |
| sperm associated antigen 17 |
| Anti-SPAG17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 200162 |
| UniProt: | Q6Q759 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPAG17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA028597 antibody. Corresponding SPAG17 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows moderate to strong positivity in cilia in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in spermatids. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA028597-100ul |
|
|
HPA028597-100ul |
|
|
HPA028597-100ul |
Produktgarantie und fachkundiger Support
