Anti-SPAG17
Catalog Number:
ATA-HPA028597
- Images (8)
| Article Name: | Anti-SPAG17 |
| Biozol Catalog Number: | ATA-HPA028597 |
| Supplier Catalog Number: | HPA028597 |
| Alternative Catalog Number: | ATA-HPA028597-100,ATA-HPA028597-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT143, FLJ34497, PF6, RP4-776P7.2 |
| sperm associated antigen 17 |
| Anti-SPAG17 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 200162 |
| UniProt: | Q6Q759 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPAG17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA028597 antibody. Corresponding SPAG17 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows moderate to strong positivity in cilia in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in spermatids. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA028597-100ul |
|
|
HPA028597-100ul |
|
|
HPA028597-100ul |
Product Guarantee and Expert Support
