Anti-RAB11FIP3
Artikelnummer:
ATA-HPA028631
- Bilder (8)
| Artikelname: | Anti-RAB11FIP3 |
| Artikelnummer: | ATA-HPA028631 |
| Hersteller Artikelnummer: | HPA028631 |
| Alternativnummer: | ATA-HPA028631-100,ATA-HPA028631-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | eferin, KIAA0665, Rab11-FIP3 |
| RAB11 family interacting protein 3 (class II) |
| Anti-RAB11FIP3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9727 |
| UniProt: | O75154 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RAB11FIP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to microtubule organizing center, cytokinetic bridge & vesicles. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
HPA028631-100ul |
|
|
HPA028631-100ul |
|
|
HPA028631-100ul |
Produktgarantie und fachkundiger Support
