Anti-RAB11FIP3
Catalog Number:
ATA-HPA028631
- Images (8)
| Article Name: | Anti-RAB11FIP3 |
| Biozol Catalog Number: | ATA-HPA028631 |
| Supplier Catalog Number: | HPA028631 |
| Alternative Catalog Number: | ATA-HPA028631-100,ATA-HPA028631-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | eferin, KIAA0665, Rab11-FIP3 |
| RAB11 family interacting protein 3 (class II) |
| Anti-RAB11FIP3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9727 |
| UniProt: | O75154 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RAB11FIP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to microtubule organizing center, cytokinetic bridge & vesicles. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
HPA028631-100ul |
|
|
HPA028631-100ul |
|
|
HPA028631-100ul |
Product Guarantee and Expert Support
