Anti-DNAJC11

Artikelnummer: ATA-HPA028705
Artikelname: Anti-DNAJC11
Artikelnummer: ATA-HPA028705
Hersteller Artikelnummer: HPA028705
Alternativnummer: ATA-HPA028705-100,ATA-HPA028705-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ10737
DnaJ (Hsp40) homolog, subfamily C, member 11
Anti-DNAJC11
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 55735
UniProt: Q9NVH1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC11
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
HPA028705-100ul