Anti-DNAJC11
Catalog Number:
ATA-HPA028705
| Article Name: |
Anti-DNAJC11 |
| Biozol Catalog Number: |
ATA-HPA028705 |
| Supplier Catalog Number: |
HPA028705 |
| Alternative Catalog Number: |
ATA-HPA028705-100,ATA-HPA028705-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Molekularbiologie |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLJ10737 |
| DnaJ (Hsp40) homolog, subfamily C, member 11 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
55735 |
| UniProt: |
Q9NVH1 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
AWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRI |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
DNAJC11 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500 |
![]()
|
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells. |
![]()
|
HPA028705-100ul |
