Anti-PPP1R3B
Artikelnummer:
ATA-HPA028731
- Bilder (7)
| Artikelname: | Anti-PPP1R3B |
| Artikelnummer: | ATA-HPA028731 |
| Hersteller Artikelnummer: | HPA028731 |
| Alternativnummer: | ATA-HPA028731-100,ATA-HPA028731-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ14005, GL, PPP1R4 |
| protein phosphatase 1, regulatory subunit 3B |
| Anti-PPP1R3B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79660 |
| UniProt: | Q86XI6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPP1R3B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human lymph node shows only very weak positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells. |
|
|
HPA028731-100ul |
|
|
HPA028731-100ul |
|
|
HPA028731-100ul |
Produktgarantie und fachkundiger Support
