Anti-PPP1R3B
Catalog Number:
ATA-HPA028731
- Images (7)
| Article Name: | Anti-PPP1R3B |
| Biozol Catalog Number: | ATA-HPA028731 |
| Supplier Catalog Number: | HPA028731 |
| Alternative Catalog Number: | ATA-HPA028731-100,ATA-HPA028731-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ14005, GL, PPP1R4 |
| protein phosphatase 1, regulatory subunit 3B |
| Anti-PPP1R3B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79660 |
| UniProt: | Q86XI6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPP1R3B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human lymph node shows only very weak positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells. |
|
|
HPA028731-100ul |
|
|
HPA028731-100ul |
|
|
HPA028731-100ul |
Product Guarantee and Expert Support
