Anti-TP53I3

Artikelnummer: ATA-HPA028742
Artikelname: Anti-TP53I3
Artikelnummer: ATA-HPA028742
Hersteller Artikelnummer: HPA028742
Alternativnummer: ATA-HPA028742-100,ATA-HPA028742-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PIG3
tumor protein p53 inducible protein 3
Anti-TP53I3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9540
UniProt: Q53FA7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TP53I3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human esophagus and skin tissues using Anti-TP53I3 antibody. Corresponding TP53I3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Western blot analysis using Anti-TP53I3 antibody HPA028742 (A) shows similar pattern to independent antibody HPA022012 (B).
HPA028742-100ul
HPA028742-100ul
HPA028742-100ul