Anti-TP53I3
Catalog Number:
ATA-HPA028742
- Images (8)
| Article Name: | Anti-TP53I3 |
| Biozol Catalog Number: | ATA-HPA028742 |
| Supplier Catalog Number: | HPA028742 |
| Alternative Catalog Number: | ATA-HPA028742-100,ATA-HPA028742-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PIG3 |
| tumor protein p53 inducible protein 3 |
| Anti-TP53I3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9540 |
| UniProt: | Q53FA7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TP53I3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human esophagus and skin tissues using Anti-TP53I3 antibody. Corresponding TP53I3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Western blot analysis using Anti-TP53I3 antibody HPA028742 (A) shows similar pattern to independent antibody HPA022012 (B). |
|
|
HPA028742-100ul |
|
|
|
|
|
HPA028742-100ul |
|
|
HPA028742-100ul |
Product Guarantee and Expert Support
