Anti-CEP120, Rabbit, Polyclonal

Artikelnummer: ATA-HPA028823
Artikelname: Anti-CEP120, Rabbit, Polyclonal
Artikelnummer: ATA-HPA028823
Hersteller Artikelnummer: HPA028823
Alternativnummer: ATA-HPA028823-100,ATA-HPA028823-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CCDC100, FLJ36090
centrosomal protein 120kDa
Anti-CEP120
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 153241
UniProt: Q8N960
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & microtubules.
Immunohistochemical staining of human pancreas shows strong membranous and cytoplasmic positivity in islet cells.