Anti-CEP120, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CEP120, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA028823
• Supplier Catalog Number: HPA028823
• Alternative Catalog Number: ATA-HPA028823-100,ATA-HPA028823-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CCDC100, FLJ36090

Product Description

centrosomal protein 120kDa

Additional Information

Anti-CEP120

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 153241
• UniProt: Q8N960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & microtubules.

Immunohistochemical staining of human pancreas shows strong membranous and cytoplasmic positivity in islet cells.