Anti-SMAD7
Artikelnummer:
ATA-HPA028897
- Bilder (9)
| Artikelname: | Anti-SMAD7 |
| Artikelnummer: | ATA-HPA028897 |
| Hersteller Artikelnummer: | HPA028897 |
| Alternativnummer: | ATA-HPA028897-100,ATA-HPA028897-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MADH7, MADH8 |
| SMAD family member 7 |
| Anti-SMAD7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4092 |
| UniProt: | O15105 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMAD7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center, cytosol & centrosome. |
|
|
Immunohistochemical staining of human lung shows nuclear positivity in pneumnocytes and macropages. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows nuclear positivity in Kupffer cells. |
|
|
HPA028897-100ul |
|
|
|
|
|
HPA028897-100ul |
|
|
HPA028897-100ul |
Produktgarantie und fachkundiger Support
